Practical 3¶
In this practical we will work with lists and tuples.
Lists¶
Python lists are ordered collections of (homogeneous) objects, but they can hold also non-homogeneous data. List are mutable objects. Elements of the collection are specified within two square brackets [] and are comma separated.
We can use the function print to print the content of lists. Some examples of list definitions follow:
In [1]:
my_first_list = [1,2,3]
print("first:" , my_first_list)
my_second_list = [1,2,3,1,3] #elements can appear several times
print("second: ", my_second_list)
fruits = ["apple", "pear", "peach", "strawberry", "cherry"] #elements can be strings
print("fruits:", fruits)
an_empty_list = []
print("empty:" , an_empty_list)
another_empty_list = list()
print("another empty:", another_empty_list)
a_list_containing_other_lists = [[1,2], [3,4,5,6]] #elements can be other lists
print("list of lists:", a_list_containing_other_lists)
my_final_example = [my_first_list, a_list_containing_other_lists]
print("a list of lists of lists:", my_final_example)
first: [1, 2, 3]
second: [1, 2, 3, 1, 3]
fruits: ['apple', 'pear', 'peach', 'strawberry', 'cherry']
empty: []
another empty: []
list of lists: [[1, 2], [3, 4, 5, 6]]
a list of lists of lists: [[1, 2, 3], [[1, 2], [3, 4, 5, 6]]]
Operators for lists¶
Python provides several operators to handle lists. The following behave like on strings (remember that as in strings, the first position is 0!):
While this requires that the whole tested obj is present in the list
and
can also change the corresponding value of the list (lists are mutable objects).
Some examples follow.
In [2]:
A = [1, 2, 3 ]
B = [1, 2, 3, 1, 2]
print("A is a ", type(A))
print(A, " has length: ", len(A))
print("A[0]: ", A[0], " A[1]:", A[1], " A[-1]:", A[-1])
print(B, " has length: ", len(B))
print("Is A equal to B?", A == B)
C = A + [1, 2]
print(C)
print("Is C equal to B?", B == C)
D = [1, 2, 3]*8
print(D)
E = D[12:18] #slicing
print(E)
print("Is A*2 equal to E?", A*2 == E)
A is a <class 'list'>
[1, 2, 3] has length: 3
A[0]: 1 A[1]: 2 A[-1]: 3
[1, 2, 3, 1, 2] has length: 5
Is A equal to B? False
[1, 2, 3, 1, 2]
Is C equal to B? True
[1, 2, 3, 1, 2, 3, 1, 2, 3, 1, 2, 3, 1, 2, 3, 1, 2, 3, 1, 2, 3, 1, 2, 3]
[1, 2, 3, 1, 2, 3]
Is A*2 equal to E? True
In [3]:
A = [1, 2, 3, 4, 5, 6]
B = [1, 3, 5]
print("A:", A)
print("B:", B)
print("Is B in A?", B in A)
print("A\'s ID:", id(A))
A[5] = [1,3,5] #we can add elements
print(A)
print("A\'s ID:", id(A))
print("A has length:", len(A))
print("Is now B in A?", B in A)
A: [1, 2, 3, 4, 5, 6]
B: [1, 3, 5]
Is B in A? False
A's ID: 140546986337864
[1, 2, 3, 4, 5, [1, 3, 5]]
A's ID: 140546986337864
A has length: 6
Is now B in A? True
list index out of range error).Consider the following example:
In [4]:
A = [1, 2, 3, 4, 5, 6]
print("A has length:", len(A))
print("First element:", A[0])
print("7th-element: ", A[6])
A has length: 6
First element: 1
---------------------------------------------------------------------------
IndexError Traceback (most recent call last)
<ipython-input-4-699e5f04cae0> in <module>()
3
4 print("First element:", A[0])
----> 5 print("7th-element: ", A[6])
IndexError: list index out of range
Example: Consider the matrix \(M = \begin{bmatrix}1 & 2 & 3\\ 1 & 2 & 1\\ 1 & 1 & 3\end{bmatrix}\) and the vector \(v=[10, 5, 10]^T\). What is the matrix-vector product \(M*v\)?
In [5]:
M = [[1, 2, 3], [1, 2, 1], [1, 1, 3]]
v = [10, 5, 10]
prod = [0, 0 ,0] #at the beginning the product is the null vector
prod[0]=M[0][0]*v[0] + M[0][1]*v[1] + M[0][2]*v[2]
prod[1]=M[1][0]*v[0] + M[1][1]*v[1] + M[1][2]*v[2]
prod[2]=M[2][0]*v[0] + M[2][1]*v[1] + M[2][2]*v[2]
print("M: ", M)
print("v: ", v)
print("M*v: ", prod)
M: [[1, 2, 3], [1, 2, 1], [1, 1, 3]]
v: [10, 5, 10]
M*v: [50, 30, 45]
Methods of the class list¶
The class list has some methods to operate on it. Recall from the lecture the following methods:
Some usage examples follow:
In [6]:
#A numeric list
A = [1, 2, 3]
print(A)
print("A has id:", id(A))
A.append(72) #appends one and only one object
print(A)
print("A has id:", id(A))
A.extend([1, 5, 124, 99]) #adds all these objects, one after the other.
print(A)
A.reverse()
print(A)
A.sort()
print(A)
print("Min value: ", A[0]) # In this simple case, could have used min(A)
print("Max value: ", A[-1]) #In this simple case, could have used max(A)
print("Number 1 appears:", A.count(1), " times")
print("While number 837: ", A.count(837))
print("\nDone with numbers, let's go strings...\n")
#A string list
fruits = ["apple", "banana", "pineapple", "cherry","pear", "almond", "orange"]
#Let's get a reverse lexicographic order:
print(fruits)
fruits.sort()
fruits.reverse()
print(fruits)
fruits.remove("banana")
print(fruits)
fruits.insert(5, "wild apple") #put wild apple after apple.
print(fruits)
print("\nSorted fruits:")
fruits.sort() # does not return anything. Modifies list!
print(fruits)
[1, 2, 3]
A has id: 140547045876232
[1, 2, 3, 72]
A has id: 140547045876232
[1, 2, 3, 72, 1, 5, 124, 99]
[99, 124, 5, 1, 72, 3, 2, 1]
[1, 1, 2, 3, 5, 72, 99, 124]
Min value: 1
Max value: 124
Number 1 appears: 2 times
While number 837: 0
Done with numbers, let's go strings...
['apple', 'banana', 'pineapple', 'cherry', 'pear', 'almond', 'orange']
['pineapple', 'pear', 'orange', 'cherry', 'banana', 'apple', 'almond']
['pineapple', 'pear', 'orange', 'cherry', 'apple', 'almond']
['pineapple', 'pear', 'orange', 'cherry', 'apple', 'wild apple', 'almond']
Sorted fruits:
['almond', 'apple', 'cherry', 'orange', 'pear', 'pineapple', 'wild apple']
Some things to remember
- append and extend work quite differently:
In [7]:
A = [1, 2, 3]
A.extend([4, 5])
print(A)
B = [1, 2, 3]
B.append([4,5])
print(B)
[1, 2, 3, 4, 5]
[1, 2, 3, [4, 5]]
- To remove an object it must exist:
In [8]:
A = [1,2,3, [[4],[5,6]], 8]
print(A)
A.remove(2)
print(A)
A.remove([[4],[5,6]])
print(A)
A.remove(7)
[1, 2, 3, [[4], [5, 6]], 8]
[1, 3, [[4], [5, 6]], 8]
[1, 3, 8]
---------------------------------------------------------------------------
ValueError Traceback (most recent call last)
<ipython-input-8-cef337401de9> in <module>()
5 A.remove([[4],[5,6]])
6 print(A)
----> 7 A.remove(7)
ValueError: list.remove(x): x not in list
- To sort a list, its elements must be sortable (i.e. homogeneous)!
In [1]:
A = [4,3, 1,7, 2]
print(A)
A.sort()
print(A)
A.append("banana")
print(A)
A.sort()
print(A)
[4, 3, 1, 7, 2]
[1, 2, 3, 4, 7]
[1, 2, 3, 4, 7, 'banana']
---------------------------------------------------------------------------
TypeError Traceback (most recent call last)
<ipython-input-1-91b77adb823f> in <module>
5 A.append("banana")
6 print(A)
----> 7 A.sort()
8 print(A)
TypeError: '<' not supported between instances of 'str' and 'int'
Important to remember:
Lists are mutable objects and this has some consequences! Since lists are mutable objects, they hold references to objects rather than objects.
Take a look at the following examples:
In [10]:
l1 = [1, 2]
l2 = [4, 3]
LL = [l1, l2]
print("l1:", l1)
print("l2:",l2)
print("LL:", LL)
l1.append(7)
print("\nAppending 7 to l1...")
print("l1:", l1)
print("LL now: ", LL)
LL[0][1] = -1
print("\nSetting LL[0][1]=-1...")
print("LL now:" , LL)
print("l1 now", l1)
#but the list can point also to a different object,
#without affecting the original list.
LL[0] = 100
print("\nSetting LL[0] = 100")
print("LL now:", LL)
print("l1 now", l1)
l1: [1, 2]
l2: [4, 3]
LL: [[1, 2], [4, 3]]
Appending 7 to l1...
l1: [1, 2, 7]
LL now: [[1, 2, 7], [4, 3]]
Setting LL[0][1]=-1...
LL now: [[1, -1, 7], [4, 3]]
l1 now [1, -1, 7]
Setting LL[0] = 100
LL now: [100, [4, 3]]
l1 now [1, -1, 7]
Making copies
In [11]:
A = ["hi", "there"]
B = A
print("A:", A)
print("B:", B)
A.extend(["from", "python"])
print("A now: ", A)
print("B now: ", B)
print("\n---- copy example -------")
#Let's make a distinct copy of A.
C = A[:] #all the elements of A have been copied in C
print("C:", C)
A[3] = "java"
print("A now:", A)
print("C now:", C)
print("\n---- be careful though -------")
#Watch out though that...
D = [A, A]
E = D[:]
print("D:", D)
print("E:", E)
D[0][0] = "hello"
print("\nD now:", D)
print("E now:", E)
print("A now:", A)
A: ['hi', 'there']
B: ['hi', 'there']
A now: ['hi', 'there', 'from', 'python']
B now: ['hi', 'there', 'from', 'python']
---- copy example -------
C: ['hi', 'there', 'from', 'python']
A now: ['hi', 'there', 'from', 'java']
C now: ['hi', 'there', 'from', 'python']
---- be careful though -------
D: [['hi', 'there', 'from', 'java'], ['hi', 'there', 'from', 'java']]
E: [['hi', 'there', 'from', 'java'], ['hi', 'there', 'from', 'java']]
D now: [['hello', 'there', 'from', 'java'], ['hello', 'there', 'from', 'java']]
E now: [['hello', 'there', 'from', 'java'], ['hello', 'there', 'from', 'java']]
A now: ['hello', 'there', 'from', 'java']
Equality and identity
In [12]:
A = [1, 2, 3]
B = A
C = [1, 2, 3]
print("Is A equal to B?", A == B)
print("Is A actually B?", A is B)
print("Is A equal to C?", A == C)
print("Is A actually C?", A is C)
#in fact:
print("\nA's id:", id(A))
print("B's id:", id(B))
print("C's id:", id(C))
#just to confirm that:
A.append(4)
B.append(5)
print("\nA now: ", A)
print("B now: ", A)
Is A equal to B? True
Is A actually B? True
Is A equal to C? True
Is A actually C? False
A's id: 140546986339208
B's id: 140546986339208
C's id: 140546977413576
A now: [1, 2, 3, 4, 5]
B now: [1, 2, 3, 4, 5]
From strings to lists, the split method¶
Strings have a method split that can literally split the string at specific characters.
Example Recall the protein seen in the previous practical:
chain_a = “”“SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKM FCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFR HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG EPHHELPPGSTKRALPNNT”“”
how can we split it into several lines?
In [9]:
chain_a = """SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKM
FCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV
RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFR
HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT
IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
EPHHELPPGSTKRALPNNT"""
lines = chain_a.split('\n')
print("Original sequence:")
print( chain_a, "\n") #some spacing to keep things clear
print("line by line:")
print("1st line:" ,lines[0])
print("2nd line:" ,lines[1])
print("3rd line:" ,lines[2])
print("4th line:" ,lines[3])
print("5th line:" ,lines[4])
print("6th line:" ,lines[5])
print("\nSplit the 1st line in correspondence to FRL:\n",lines[0].split("FRL"))
Original sequence:
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKM
FCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV
RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFR
HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT
IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
EPHHELPPGSTKRALPNNT
line by line:
1st line: SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKM
2nd line: FCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV
3rd line: RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFR
4th line: HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT
5th line: IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
6th line: EPHHELPPGSTKRALPNNT
Split the 1st line in correspondence to FRL:
['SSSVPSQKTYQGSYG', 'GFLHSGTAKSVTCTYSPALNKM']
Note that in the last instruction, the substring FRL is disappeared (as happened to the newline).
And back to strings with the join method¶
Given a list, one can join the elements of the list together into a
string by using the join method of the class string. The syntax is
the following: str.join(list) which joins together all the elements in
the list in a string separating them with the string str.
Example Given the list [‘Oct’, ‘5’, ‘2018’, ‘15:30’], let’s combine all its elements in a string joining the elements with a dash (“-“) and print them. Let’s finally join them with a tab (“\t”) and print them.
In [3]:
vals = ['Oct', '5th', '2018', '15:30']
print(vals)
myStr = "-".join(vals)
print("\n" + myStr)
myStr = "\t".join(vals)
print("\n" + myStr)
['Oct', '5th', '2018', '15:30']
Oct-5th-2018-15:30
Oct 5th 2018 15:30
Tuples¶
Tuples are the immutable version of lists (i.e. it is not possible to change their content without actually changing the object). They are sequential collections of objects, and elements of tuples are assumed to be in a particular order. They can hold heterogeneous information. They are defined with the brackets (). Some examples:
In [14]:
first_tuple = (1,2,3)
print(first_tuple)
second_tuple = (1,) #this contains one element only, but we need the comma!
var = (1) #This is not a tuple!!!
print(second_tuple, " type:", type(second_tuple))
print(var, " type:", type(var))
empty_tuple = () #fairly useless
print(empty_tuple, "\n")
third_tuple = ("January", 1 ,2007) #heterogeneous info
print(third_tuple)
days = (third_tuple,("February",2,1998), ("March",2,1978),("June",12,1978))
print(days, "\n")
#Remember tuples are immutable objects...
print("Days has id: ", id(days))
days = ("Mon","Tue","Wed","Thu","Fri","Sat","Sun")
#...hence reassignment creates a new object
print("Days now has id: ", id(days))
(1, 2, 3)
(1,) type: <class 'tuple'>
1 type: <class 'int'>
()
('January', 1, 2007)
(('January', 1, 2007), ('February', 2, 1998), ('March', 2, 1978), ('June', 12, 1978))
Days has id: 140546977398040
Days now has id: 140546995078232
The following operators work on tuples and they behave exactly as on lists:
In [15]:
practical1 = ("Friday", "28/09/2018")
practical2 = ("Tuesday", "02/10/2018")
practical3 = ("Friday", "05/10/2018")
#A tuple containing 3 tuples
lectures = (practical1, practical2, practical3)
#One tuple only
mergedLectures = practical1 + practical2 + practical3
print("The first three lectures:\n", lectures, "\n")
print("mergedLectures:\n", mergedLectures)
#This returns the whole tuple
print("1st lecture was on: ", lectures[0], "\n")
#2 elements from the same tuple
print("1st lecture was on ", mergedLectures[0], ", ", mergedLectures[1], "\n")
# Return type is tuple!
print("3rd lecture was on: ", lectures[2])
#2 elements from the same tuple returned in tuple
print("3rd lecture was on ", mergedLectures[4:], "\n")
The first three lectures:
(('Friday', '28/09/2018'), ('Tuesday', '02/10/2018'), ('Friday', '05/10/2018'))
mergedLectures:
('Friday', '28/09/2018', 'Tuesday', '02/10/2018', 'Friday', '05/10/2018')
1st lecture was on: ('Friday', '28/09/2018')
1st lecture was on Friday , 28/09/2018
3rd lecture was on: ('Friday', '05/10/2018')
3rd lecture was on ('Friday', '05/10/2018')
The following methods are available for tuples:
In [16]:
practical1 = ("Friday", "28/09/2018")
practical2 = ("Tuesday", "02/10/2018")
practical3 = ("Friday", "05/10/2018")
mergedLectures = practical1 + practical2 + practical3 #One tuple only
print(mergedLectures.count("Friday"), " lectures were on Friday")
print(mergedLectures.count("Tuesday"), " lecture was on Tuesday")
print("Index:", practical2.index("Tuesday"))
print("Index:", practical2.index("Wednesday"))
2 lectures were on Friday
1 lecture was on Tuesday
Index: 0
---------------------------------------------------------------------------
ValueError Traceback (most recent call last)
<ipython-input-16-fc543d476575> in <module>()
9
10 print("Index:", practical2.index("Tuesday"))
---> 11 print("Index:", practical2.index("Wednesday"))
ValueError: tuple.index(x): x not in tuple
Exercises¶
Given the following text string:
"""this is a text string on several lines that does not say anything."""
- print it; b) print how many lines, words and characters it contains. Finally, c)sort the words alphabetically and print the first and the last in lexicographic order.
Show/Hide Solution
- The variant calling format (VCF) is a format to represent structural variants of genomes (i.e. SNPs, insertions, deletions) . Each line of this format represents a variant, every piece of information within a line is separated by a tab (\t in python). The first 5 fields of this format report the chromosome (chr), the position (pos), the name of the variant (name), the reference allele (REF) and the alternative allele (ALT). Assuming to have a variable VCF defined containing the following three lines (representing three SNPs):
VCF = “”“MDC000001.124\t7112\tFB_AFFY_0000024\tG\tA MDC000002.328\t941\tFB_AFFY_0000144\tC\tT MDC000004.272\t2015\tFB_AFFY_0000222\tG\tA”“”
1. Store these three variants as a list of lists, where each one of the fields is kept separate
(e.g. the list should be similar to:
[[chr1,pos1,name1,ref1,alt1], [chr2, pos2, name2, ref2, alt2], ...] where all the elements
are as specified in the string VCF (note that "..." means that the list is not complete).
2. Print each variant changing its format in: "name|chr|pos|REF/ALT".
Show/Hide Solution
Given the list L = [“walnut”, “eggplant”, “lemon”, “lime”, “date”, “onion”, “nectarine”, “endive” ]:
1. Create another list (called newList) containing the first letter of each element of L (e.g newList =["w", "e", ...]). 2. Add a space to newList at position 4 and append an exclamation mark (!) at the end. 3. Print the list. 4. Print the content of the list joining all the elements with an empty space (i.e. use the method join: "".join(newList) )
Show/Hide Solution
- Fastq is a standard format for storing sequences and quality information. More information on the format can be found here. This format can be used to store sequencing information coming from the sequencer. Each entry represents a read (i.e. a sequence) and carries four different pieces of information. A sample entry is the following:
@HWI-ST1296:75:C3F7CACXX:1:1101:19142:14904 CCAACAACTTTGACGCTAAGGATAGCTCCATGGCAGCATATCTGGCACAA + FHIIJIJJGIJJJJJIHHHFFFFFEE:;CIDDDDDDDDDDDDEDDDDDDB”“”
where:
- the first line is the read identifier starts with a “@” and carries several types of information regarding the instrument used for sequencing (the reported example is an illumina read - if you are interested, you can find more info on the format of the ID here.
- (ii). the second information is the sequence of the read (note that it can span several lines, not in our simple example though);
- a “+” sign to mark the end of the sequence information (optionally the read identifier can be repeated);
- the phred quality score of the read encoded as a text string. It must contain the same number of elements that are in the sequence. To decode each character into a the corresponding phred score, one needs to convert it into the unicode integer representation of it - 33. For example, the conversion of a character “I” in python can be done using the ord built in function in the following way: ord(“I”) - 33 = 40. Finally the phred score can be converted into probability of the base to be wrong with the following formula: \(P = 10^{-Q/10}\), where \(Q\) is the phred quality score.
Given the entry above:
1. Check that the ID starts with a @
2. Store the sequence as a string and as list where each element is one single base
(e.g. sequence =['T', 'A',...])
3. Store the quality as a list where each element is one single quality character
(e.g. qualChar = ['C', 'C', ...])
4. Check that the length of the sequence and quality are the same
(hint: use the sequence string, not the list)
5. Count how many times the sequence "TCCA" appears in the read
6. Retrieve the sub-list containing the quality values corresponding to the "TCCA" string
7. Convert each value in the list at point 6 in the corresponding probability of the base
being wrong
Show/Hide Solution
- Given the list L = [10, 60, 72, 118, 11, 71, 56, 89, 120, 175] find the min, max and median value (hint: sort it and extract the right values). Create a list with only the elements at even indexes (i.e. [10, 72, 11, ..], note that the “..” means that the list is not complete) and re-compute min, max and median values. Finally, re-do the same for the elements located at odd indexes (i.e. [60, 118,..]).
Show/Hide Solution
- Given the string pets = “siamese cat,dog,songbird,guinea pig,rabbit,hampster” convert it into a list. Create then a tuple of tuples where each tuple has two information: the name of the pet and the length of the name. E.g. ((“dog”,3), ( “hampster”,8)). Print the tuple.
Show/Hide Solution
- Given the string
S=”apple|pear|apple|cherry|pear|apple|pear|pear|cherry|pear|strawberry”.
Store the elements separated by the “|” in a list.
- How many elements does the list have?
- Knowing that the list created at the previous point has only four distinct elements (i.e. “apple”,”pear”,”cherry” and “strawberry”), create another list where each element is a tuple containing the name of the fruit and its multiplicity (that is how many times it appears in the original list). Ex. list_of_tuples = [(“apple”, 3), (“pear”, “5”),…]
- Print the content of each tuple in a separate line (ex. first line: apple is present 3 times)
Show/Hide Solution
- Define three tuples representing points in the 3D space: A =
(10,20,30), B = (1,72, 100) and C = (4, 9, 20).
- Compute the Euclidean distance between A and B (let’s call it AB), A and C (AC), B and C (BC) and print them. Remember that the distance \(d\) between two points \(X_1 = (x_1,y_1,z_1)\) and \(X_2 = (x_2,y_2,z_2)\) is \(d = \sqrt{(x_2-x_1)^2 + (y_2 - y_1)^2 + (z_2-z_1)^2}\). Hint: remember to import math to use the sqrt method.
- Create a point D multiplying every element of C by 10. (Hint: do not use C*10, as this will repeat C 10 times). And compute the distance AD, BD, CD.
- Answer to the following questions (writing a suitable boolean
expression and printing the result):
- Is A closer to B than to C?
- Is A closer to C than to B or to D?
- Is B closer to A than to C to D?
Show/Hide Solution
- Given the matrix \(M =\begin{bmatrix}1 & 2 & 3\\ 4 & 5 & 6\\ 7 & 8 & 9\end{bmatrix}\) compute \(M^2 = \begin{bmatrix}1 & 2 & 3\\ 4 & 5 & 6\\ 7 & 8 & 9\end{bmatrix} \times \begin{bmatrix}1 & 2 & 3\\ 4 & 5 & 6\\ 7 & 8 & 9\end{bmatrix} = \begin{bmatrix}30 & 36 & 42\\ 66 & 81 & 96\\ 102 & 126 & 150\end{bmatrix}\)
Show/Hide Solution